Anti-EP4 receptor (C-term.) conjugated to surelight APC, UoM: 1 * 50 µG
Item Number: COBSD3-1866-50
Unit of Measure: 50 MCG
Synonyms: Antibody;Antilichaam;Antibodies;antistoffen;GST-tag;His-tag;IgA;IgD;IgE;IgG;IgM;Immunoglobulin;Isotype control;MAB;PAB;Monoclonal;Polyclonal;dt5d3;Antistof;Anticuerpos;Vasta-aine;iggy antibody selector
Manufacturer: COLUMBIA BIOSCIENCES
Manufacturer Number: D3-1866-50
Storage Temperature: Fridge (+4)
Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
Ihr dynamisches Snippet wird hier angezeigt ...
Diese Meldung wird angezeigt, weil Sie weder einen Filter noch eine Vorlage zur Verwendung bereitgestellt haben.